ZNF654 Rabbit Polyclonal Antibody

SKU TA331868

Rabbit Polyclonal Anti-ZNF654 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF654 Antibody: synthetic peptide directed towards the middle region of human ZNF654. Synthetic peptide located within the following region: TKSHRTFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPESSAQPSETIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: zinc finger protein 654
• Database Link:
  NP_060763
• Background: The ZNF654 gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.
• Synonyms: FLJ10997; FLJ21142
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 82%

Reference Data