DEPDC1B Rabbit Polyclonal Antibody

SKU TA331863

Rabbit Polyclonal Anti-DEPDC1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DEPDC1B Antibody is: synthetic peptide directed towards the N-terminal region of Human DEPDC1B. Synthetic peptide located within the following region: FGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: DEP domain containing 1B
• Database Link:
  NP_060839
  Q8WUY9
• Background: The function of this protein remains unknown.
• Synonyms: BRCC3; XTP1
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data