ZNF398 Rabbit Polyclonal Antibody

CAT#: TA331814

Rabbit Polyclonal Anti-ZNF398 Antibody

Product Images

WB Suggested Anti-ZNF398 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF398 Antibody: synthetic peptide directed towards the middle region of human ZNF398. Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: zinc finger protein 398
• Database Link:
  NP_065832
  Entrez Gene 57541 Human
  UniProt ID Q8TD17
• Background: ZNF398 is a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. This protein acts as a transcriptional activator.This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined.
• Synonyms: P51; P71; ZER6
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Mouse: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors