ZNF537 (TSHZ3) Rabbit Polyclonal Antibody

SKU TA331811

Rabbit Polyclonal Anti-ZNF537 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF537 Antibody: synthetic peptide directed towards the middle region of human ZNF537. Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 98 kDa
• Gene Name: teashirt zinc finger homeobox 3
• Database Link:
  NP_065907
  Q63HK5
• Background: The ZNF537 gene is located on chromosome 19.
• Synonyms: TSH3; ZNF537
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Mouse: 85%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors