Ocular development associated gene (GATAD1) Rabbit Polyclonal Antibody

SKU TA331797

Rabbit Polyclonal Anti-GATAD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GATAD1 Antibody: synthetic peptide directed towards the C terminal of human GATAD1. Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: GATA zinc finger domain containing 1
• Database Link:
  NP_066990
  Q8WUU5
• Background: ODAG (Ocular development-associated gene), a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue.
• Synonyms: CMD2B; ODAG; RG083M05.2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors