PRDM12 Rabbit Polyclonal Antibody

SKU TA331788

Rabbit Polyclonal Anti-PRDM12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRDM12 Antibody: synthetic peptide directed towards the N terminal of human PRDM12. Synthetic peptide located within the following region: SFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: PR domain 12
• Database Link:
  NP_067632
  Q9H4Q4
• Background: PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.
• Synonyms: HSAN8; PFM9
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 91%; Zebrafish: 83%

Reference Data