UTP14C Rabbit Polyclonal Antibody

CAT#: TA331786

Rabbit Polyclonal Anti-UTP14C Antibody

Product Images

Host: Rabbit; Target Name: UTP14C; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; UTP14C is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UTP14C Antibody is: synthetic peptide directed towards the C-terminal region of Human UTP14C. Synthetic peptide located within the following region: EAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: UTP14, small subunit processome component homolog C (S. cerevisiae)
• Database Link:
  NP_067677
  Entrez Gene 9724 Human
  UniProt ID Q5TAP6
• Background: UTP14C is essential for spermatogenesis. It may be required specifically for ribosome biogenesis and hence protein synthesis during male meiosis
• Synonyms: 2700066J21Rik; KIAA0266; UTP14B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 86%; Mouse: 77%