RMND5B Rabbit Polyclonal Antibody

SKU TA331766

Rabbit Polyclonal Anti-RMND5B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RMND5B Antibody is: synthetic peptide directed towards the N-terminal region of Human RMND5B. Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: required for meiotic nuclear division 5 homolog B
• Database Link:
  NP_073599
  Q96G75
• Background: The function of this protein remains unknown.
• Synonyms: GID2; GID2B
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency