TAS2R13 Rabbit Polyclonal Antibody

CAT#: TA331761

Rabbit Polyclonal Anti-TAS2R13 Antibody

Product Images

Host: Rabbit; Target Name: TAS2R13; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAS2R13 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R13. Synthetic peptide located within the following region: HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: taste 2 receptor member 13
• Database Link:
  NP_076409
  Entrez Gene 50838 Human
  UniProt ID Q9NYV9
• Background: This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organized in the genome in clusters and are genetically linked to loci that influence bitter perception in mice and humans. In functional expression studies, they respond to bitter tastants. This gene maps to the taste receptor gene cluster on chromosome 12p13.
• Synonyms: T2R13; TRB3
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Taste transduction