DHX40 Rabbit Polyclonal Antibody

SKU TA331740

Rabbit Polyclonal Anti-DHX40 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DHX40 Antibody is: synthetic peptide directed towards the C-terminal region of Human DHX40. Synthetic peptide located within the following region: KQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQDHSDTRKETG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 86 kDa
• Gene Name: DEAH-box helicase 40
• Database Link:
  NP_078888
  Q8IX18
• Background: This gene encodes a member of the DExH/D box family of ATP-dependent RNA helicases that have an essential role in RNA metabolism. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 17.
• Synonyms: ARG147; DDX40; PAD
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data