TEFM Rabbit Polyclonal Antibody

SKU TA331737

Rabbit Polyclonal Anti-TEFM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEFM Antibody is: synthetic peptide directed towards the N-terminal region of Human TEFM. Synthetic peptide located within the following region: NLESLMNVPLFKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: transcription elongation factor, mitochondrial
• Database Link:
  NP_078959
  Q96QE5
• Background: TEFM is a transcription elongation factor which increases mitochondrial RNA polymerase processivity. It regulates transcription of the mitochondrial genome, including genes important for the oxidative phosphorylation machinery.
• Synonyms: C17orf42
• Note: Immunogen sequence homology: Human: 100%

Reference Data