MYO19 Rabbit Polyclonal Antibody

SKU TA331724

Rabbit Polyclonal Anti-MYO19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYO19 Antibody is: synthetic peptide directed towards the N-terminal region of Human MYO19. Synthetic peptide located within the following region: LQQVNGHNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTRVNPVTLETV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: myosin XIX
• Database Link:
  NP_079385
  Q96H55
• Background: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. MYO19 is involved in mitochondrial motility.
• Synonyms: MYOHD1
• Note: Immunogen sequence homology: Human: 100%

Reference Data