MYO19 Rabbit Polyclonal Antibody

CAT#: TA331724

Rabbit Polyclonal Anti-MYO19 Antibody

Product Images

Host: Rabbit; Target Name: MYO19; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYO19 Antibody is: synthetic peptide directed towards the N-terminal region of Human MYO19. Synthetic peptide located within the following region: LQQVNGHNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTRVNPVTLETV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: myosin XIX
• Database Link:
  NP_079385
  Entrez Gene 80179 Human
  UniProt ID Q96H55
• Background: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. MYO19 is involved in mitochondrial motility.
• Synonyms: MYOHD1
• Note: Immunogen sequence homology: Human: 100%