MRPL32 Rabbit Polyclonal Antibody

SKU
TA331699
Rabbit Polyclonal Anti-MRPL32 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-MRPL32 Antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL32. Synthetic peptide located within the following region: CYEKVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRII
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 21 kDa
Gene Name mitochondrial ribosomal protein L32
Database Link
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L32 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome Xp.
Synonyms bMRP-59b; HSPC283; L32mt; MRP-L32
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Rabbit: 93%; Guinea pig: 93%; Sheep: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 86%; Horse: 79%
Reference Data
Write Your Own Review
You're reviewing:MRPL32 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.