RHOXF2 Rabbit Polyclonal Antibody

SKU TA331692

Rabbit Polyclonal Anti-RHOXF2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RHOXF2 Antibody: synthetic peptide directed towards the middle region of human RHOXF2. Synthetic peptide located within the following region: DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: Rhox homeobox family member 2
• Database Link:
  NP_115887
  Q9BQY4
• Background: RHOXF2 belongs to the paired-like homeobox family, PEPP subfamily. It contains 1 homeobox DNA-binding domain. The function of RHOXF2 remains unknown.
• Synonyms: CT107; PEPP-2; PEPP2; THG1
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%

Reference Data

• Protein Families: Transcription Factors