RHOXF2 Rabbit Polyclonal Antibody

CAT#: TA331692

Rabbit Polyclonal Anti-RHOXF2 Antibody

Product Images

WB Suggested Anti-RHOXF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

• 

  Human Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RHOXF2 Antibody: synthetic peptide directed towards the middle region of human RHOXF2. Synthetic peptide located within the following region: DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: Rhox homeobox family member 2
• Database Link:
  NP_115887
  Entrez Gene 84528 Human
  UniProt ID Q9BQY4
• Background: RHOXF2 belongs to the paired-like homeobox family, PEPP subfamily. It contains 1 homeobox DNA-binding domain. The function of RHOXF2 remains unknown.
• Synonyms: CT107; PEPP-2; PEPP2; THG1
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%

Reference Data

• Protein Families: Transcription Factors