Ggact Rabbit Polyclonal Antibody

SKU TA331641

Rabbit Polyclonal Anti-Ggact Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-A2ld1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse A2ld1. Synthetic peptide located within the following region: WEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: gamma-glutamylamine cyclotransferase
• Database Link:
  NP_663441
  Q923B0
• Background: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.
• Synonyms: A2ld1; RGD1304748
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Horse: 86%; Bovine: 86%

Reference Data