DEFB119 Rabbit Polyclonal Antibody

SKU TA331614

Rabbit Polyclonal Anti-DEFB119 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DEFB119 Antibody is: synthetic peptide directed towards the N-terminal region of Human DEFB119. Synthetic peptide located within the following region: LLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 9 kDa
• Gene Name: defensin beta 119
• Database Link:
  NP_695021
  Q8N690
• Background: This gene encodes a member of a family of small secreted proteins. These proteins participate in immune defense against microbial infection. This gene is located in a cluster of similar genes on chromosome 20. Alternative splicing results in multiple transcript variants.
• Synonyms: DEFB-19; DEFB-20; DEFB20; DEFB120; ESC42-RELA; ESC42-RELB
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Horse: 92%; Rat: 85%; Guinea pig: 82%; Dog: 77%

Reference Data

• Protein Families: Secreted Protein