MFSD4B Rabbit Polyclonal Antibody

SKU
TA331610
Rabbit Polyclonal Anti-KIAA1919 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KIAA1919 Antibody is: synthetic peptide directed towards the middle region of Human KIAA1919. Synthetic peptide located within the following region: YAVIGTYMFLVSVIFFCLFLKNSSKQEKARASAETFRRAKYHNALLCLLF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name major facilitator superfamily domain containing 4B
Database Link
Background KIAA1919 may function as a sodium-dependent glucose transporter.
Synonyms MFSD4B; NaGLT1
Note Immunogen sequence homology: Human: 100%; Bovine: 86%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:MFSD4B Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.