GPR111 (ADGRF2) Rabbit Polyclonal Antibody

SKU TA331605

Rabbit Polyclonal Anti-GPR111 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR111 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR111. Synthetic peptide located within the following region: TESCRTLYQAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: adhesion G protein-coupled receptor F2
• Database Link:
  NP_722581
  Q8IZF7
• Background: GPR111 is a orphan receptor.
• Synonyms: GPR111; hGPCR35; PGR20
• Note: Immunogen sequence homology: Human: 100%; Horse: 85%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane