NUDT14 Rabbit Polyclonal Antibody

SKU TA331572

Rabbit Polyclonal Anti-NUDT14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NUDT14 Antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT14. Synthetic peptide located within the following region: PYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: nudix hydrolase 14
• Database Link:
  NP_803877
  O95848
• Background: UDP-glucose (UDPG) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. NUDT14 is a UDPG pyrophosphatase that hydrolyzes UDPG to produce glucose 1-phosphate and UMP.
• Synonyms: UGPP; UGPPase
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 86%; Mouse: 79%

Reference Data