ZNF598 Rabbit Polyclonal Antibody

SKU TA331566

Rabbit Polyclonal Anti-ZNF598 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF598 Antibody: synthetic peptide directed towards the middle region of human ZNF598. Synthetic peptide located within the following region: EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPGALPPPSPKLKDEDFPS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 99 kDa
• Gene Name: zinc finger protein 598
• Database Link:
  NP_835461
  Q86UK7
• Background: ZNF598 contains 1 C2H2-type zinc finger and 1 RING-type zinc finger. The exact function of ZNF598 remains unknown.
• Synonyms: DKFZp762F135; FLJ00086
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Mouse: 85%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome