Protein cornichon homolog 2 (CNIH2) Rabbit Polyclonal Antibody

CAT#: TA331544

Rabbit Polyclonal Anti-CNIH2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of cornichon homolog 2 (Drosophila) (CNIH2)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human cornichon homolog 2 (Drosophila) (CNIH2), 20 µg
    • 20 ug

USD 867.00

Other products for "Protein cornichon homolog 2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNIH2. Synthetic peptide located within the following region: AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 19 kDa
Gene Name cornichon family AMPA receptor auxiliary protein 2
Background The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants.
Synonyms CNIH-2; Cnil
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.