Protein cornichon homolog 2 (CNIH2) Rabbit Polyclonal Antibody

SKU TA331544

Rabbit Polyclonal Anti-CNIH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNIH2. Synthetic peptide located within the following region: AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: cornichon family AMPA receptor auxiliary protein 2
• Database Link:
  NP_872359
  Q6PI25
• Background: The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants.
• Synonyms: CNIH-2; Cnil
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane