GDPD1 Rabbit Polyclonal Antibody

SKU TA331543

Rabbit Polyclonal Anti-GDPD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GDPD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human GDPD1. Synthetic peptide located within the following region: IWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: glycerophosphodiester phosphodiesterase domain containing 1
• Database Link:
  NP_872375
  Q8N9F7
• Background: This gene encodes a member of the glycerophosphodiester phosphodiesterase family of enzymes that catalyze the hydrolysis of deacylated glycerophospholipids to glycerol phosphate and alcohol. The encoded protein is localized to the cytoplasm and concentrates near the perinuclear region. Alternative splicing results in multiple transcript variants.
• Synonyms: GDE4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane