Polyserase1 (TMPRSS9) Rabbit Polyclonal Antibody

SKU TA331538

Rabbit Polyclonal Anti-TMPRSS9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMPRSS9 Antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS9. Synthetic peptide located within the following region: PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: transmembrane protease, serine 9
• Database Link:
  NP_892018
  Q7Z410
• Background: Serase-1 and serase-2 are serine proteases that hydrolyze the peptides N-t-Boc-Gln-Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC. In contrast, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Ala-Pro-Ala-AMC are not significantly hydrolyzed.
• Synonyms: FLJ16193
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Horse: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane