Polyserase1 (TMPRSS9) Rabbit Polyclonal Antibody

CAT#: TA331538

Rabbit Polyclonal Anti-TMPRSS9 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transmembrane protease, serine 9 (TMPRSS9)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Polyserase1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TMPRSS9 Antibody is: synthetic peptide directed towards the C-terminal region of Human TMPRSS9. Synthetic peptide located within the following region: PVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name transmembrane protease, serine 9
Background Serase-1 and serase-2 are serine proteases that hydrolyze the peptides N-t-Boc-Gln-Ala-Arg-AMC and N-t-Boc-Gln-Gly-Arg-AMC. In contrast, N-t-Boc-Ala-Phe-Lys-AMC and N-t-Boc-Ala-Pro-Ala-AMC are not significantly hydrolyzed.
Synonyms FLJ16193
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Horse: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.