FAM73A (MIGA1) Rabbit Polyclonal Antibody

SKU TA331522

Rabbit Polyclonal Anti-FAM73A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM73A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM73A. Synthetic peptide located within the following region: SRQNLTLSLSSTKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: family with sequence similarity 73 member A
• Database Link:
  NP_940951
  Q8NAN2
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp686M07166; FLJ35093
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Bovine: 86%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane