KCTD1 Rabbit Polyclonal Antibody

CAT#: TA331513

Reviews ()
Write a review

Rabbit Polyclonal Anti-KCTD1 Antibody

Get 29% off western blot control. View details.

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KCTD1 Antibody is: synthetic peptide directed towards the middle region of Human KCTD1. Synthetic peptide located within the following region: EEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name potassium channel tetramerization domain containing 1
Background KCTD1 may repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent.
Synonyms C18orf5; SENS
Note Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Protein Families Ion Channels: Other
Other products for "KCTD1"
Frequently bought together (3)
Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2
    • 20 ug

USD 748.00

Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2
    • 100 ug

USD 360.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
Clone ID reveals the Source of Monoclonal Antibodies