G3BP (G3BP1) Rabbit Polyclonal Antibody

CAT#: TA331473

Rabbit polyclonal Anti-G3BP1 Antibody

Product Images

Lanes: 1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug); Primary Antibody Dilution: 2ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution: 1: 20,000; Gene Name: G3BP1; Submitted by:

• 

  WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysateG3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

• 

  Amount and Sample Type : 500 ug rat brain homogenate; Amount of IP Antibody : 6 ug; Primary Antibody : G3BP1; Primary Antibody Dilution : 1:500; Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution : 1:5000; Gene Name : G3BP1

• 

  IP Suggested Anti-G3BP1 Antibody ; Positive Control: NT2 CELL/BRAIN TISSUE

Specifications

Product Data

• Applications: IP, WB
• Recommended Dilution: WB, IP
• Reactivities: Rat, Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: G3BP stress granule assembly factor 1
• Database Link:
  NP_005745
  Entrez Gene 27041 MouseEntrez Gene 171092 RatEntrez Gene 10146 Human
  UniProt ID Q13283
• Background: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding
• Synonyms: G3BP; HDH-VIII
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome