G3BP (G3BP1) Rabbit Polyclonal Antibody

SKU TA331473

Rabbit polyclonal Anti-G3BP1 Antibody

Product Data

• Application: IP, WB
• Recommended Dilution: WB, IP
• Reactivity: Human, Mouse, Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: G3BP stress granule assembly factor 1
• Database Link:
  NP_005745
  Q13283
• Background: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding
• Synonyms: G3BP; HDH-VIII
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome