KCNK5 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of potassium channel, subfamily K, member 5 (KCNK5)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "KCNK5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNK5 antibody: synthetic peptide directed towards the C terminal of human KCNK5. Synthetic peptide located within the following region: TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | potassium two pore domain channel subfamily K member 5 |
Database Link | |
Background | KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. |
Synonyms | K2p5.1; KCNK5b; TASK-2; TASK2 |
Note | Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Rabbit: 92% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.