SLC35B2 Rabbit Polyclonal Antibody

CAT#: TA331358

Rabbit Polyclonal Anti-SLC35B2 Antibody

Product Images

WB Suggested Anti-SLC35B2 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35B2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35B2. Synthetic peptide located within the following region: CLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: solute carrier family 35 member B2
• Database Link:
  NP_835361
  Entrez Gene 347734 Human
  UniProt ID Q8TB61
• Background: Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen.
• Synonyms: PAPST1; SLL; UGTrel4
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane