SHC4 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 69 kDa |
Gene Name | SHC adaptor protein 4 |
Database Link | |
Background | SHC4 activates both Ras-dependent and Ras-independent migratory pathways in melanomas. It contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1. |
Synonyms | RaLP; SHCD |
Note | Human: 100% |
Reference Data | |
Protein Pathways | Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Focal adhesion, Glioma, Insulin signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review