DYNC1LI2 Rabbit Polyclonal Antibody

SKU TA331324

Rabbit Polyclonal Anti-DYNC1LI2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DYNC1LI2 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC1LI2. Synthetic peptide located within the following region: KLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: dynein cytoplasmic 1 light intermediate chain 2
• Database Link:
  NP_006132
  O43237
• Background: Cytoplasmic dynein is a microtubule-associated motor protein.
• Synonyms: DNCLI2; LIC2
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome