D2HGDH Rabbit Polyclonal Antibody

CAT#: TA331322

Reviews ()
Write a review

Rabbit Polyclonal Anti-D2HGDH Antibody



USD 539.00


Availability*
5 Days

Size
    • 100 ul


Product images

Other products for "D2HGDH"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the N-terminal region of Human D2HGDH. Synthetic peptide located within the following region: AFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name D-2-hydroxyglutarate dehydrogenase
Background The function of this protein remains unknown.
Synonyms D2HGD
Note Human: 100%; Rat: 93%; Dog: 92%; Rabbit: 92%; Mouse: 86%; Pig: 85%; Guinea pig: 85%; Horse: 79%; Bovine: 79%; Zebrafish: 77%
Reference Data
Frequently bought together (3)
Recombinant protein of human D-2-hydroxyglutarate dehydrogenase (D2HGDH), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 2,950.00


Transient overexpression lysate of D-2-hydroxyglutarate dehydrogenase (D2HGDH), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.