Spaca3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Spaca3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Spaca3. Synthetic peptide located within the following region: RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 24 kDa |
| Gene Name | sperm acrosome associated 3 |
| Database Link | |
| Background | Spaca3 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro? |
| Synonyms | 1700025M08Rik; ALLP17; CT54; LYC3; LYZL3; MGC119058; SLLP1; SPRASA |
| Note | Horse: 100%; Human: 100%; Pig: 93%; Rat: 92%; Dog: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins, Secreated Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Testes and duct deferens of mice during space flight: cytoskeleton structure, sperm-specific proteins and epigenetic events
Ogneva, Usik, Loktev et al
Sci Rep (2019) 9 (1), 9730 DOI: 10.1038/s41598-019-46324-3
Ogneva, Usik, Loktev et al
Sci Rep (2019) 9 (1), 9730 DOI: 10.1038/s41598-019-46324-3
AI Summary: OriGene’s SPACA3 antibody was used to assess sperm-specific protein levels in mouse testes and duct deferens, helping the researchers evaluate the effects of space flight on reproductive tissues.
Snippet: istone acetylase KAT1/HAT1 (1: 1000), and histone deacetylase HDAC1 (1: 1000) (Abcam, UK);JARID1B (KDM5B) (1: 100) (Bioss Antibodies, USA);protamine (1: 250) (Sigma, Germany);and SPACA3 (1: 1000) (OriGene, USA). Biotinylated goat antibodies against mouse IgG (1:20,000) (Sigma, Germany) and rabbit IgG (1:10,000) (Jackson ImmunoResearch Lab, Inc., USA) were used as secondary antibodies. Further,
Cytoskeleton Structure in Mouse Sperm and Testes After 30 Days of Hindlimb Unloading and 12 Hours of Recovery
Usik, Ogneva
Cell. Physiol. Biochem. (2018) 51 (1), 375-392 DOI: 10.1159/000495235
Usik, Ogneva
Cell. Physiol. Biochem. (2018) 51 (1), 375-392 DOI: 10.1159/000495235
AI Summary: In this study, OriGene's SPACA3 antibody was used to assess the expression levels of the SPACA3 protein in mouse sperm and testis, contributing to the analysis of cytoskeletal and sperm-specific gene changes after simulated weightlessness and recovery.
Snippet: manufacturers to determine the expression levels of each protein: rabbit antibodies against JARID1B (KDM5B) diluted 1: 100 (Bioss Antibodies, Woburn, MA), protamine diluted 1: 250 (Sigma-Aldrich, Darmstadt, Germany), and SPACA3 diluted 1: 1000 (OriGene, Rockville
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
