Keratin 77 (KRT77) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KRT77 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT77. Synthetic peptide located within the following region: VRTQYELIAQRSKDEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNR |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 62 kDa |
Gene Name | keratin 77 |
Database Link | |
Background | Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is expressed in the skin and eccrine sweat glands. The type II keratins are clustered in a region of chromosome 12q13. |
Synonyms | K1B; KRT1B |
Note | Human: 100%; Rat: 93%; Mouse: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.