HABP4 Rabbit Polyclonal Antibody

SKU
TA331261
Rabbit Polyclonal Anti-HABP4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-HABP4 antibody is: synthetic peptide directed towards the N-terminal region of Human HABP4. Synthetic peptide located within the following region: KERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLER
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 33 kDa
Gene Name hyaluronan binding protein 4
Database Link
Background HABP4 may be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription.
Synonyms 57; IHABP-4; IHABP4; Ki-1; SERBP1L
Note Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Rabbit: 92%; Pig: 85%; Guinea pig: 85%
Reference Data
Write Your Own Review
You're reviewing:HABP4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.