ARHGAP22 Rabbit Polyclonal Antibody

SKU TA331244

Rabbit Polyclonal Anti-ARHGAP22 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ARHGAP22 antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP22. Synthetic peptide located within the following region: AGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 77 kDa
• Gene Name: Rho GTPase activating protein 22
• Database Link:
  NP_067049
  Q7Z5H3
• Background: This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-dependent 14-3-3 binding protein which binds sequentially to two serine residues. The result of these interactions is regulation of cell motility. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: RhoGAP2; RhoGap22
• Note: Human: 100%

Reference Data