Mitochondrial dicarboxylate carrier (SLC25A10) Rabbit Polyclonal Antibody

SKU TA331226

Rabbit Polyclonal Anti-SLC25A10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A10 antibody is: synthetic peptide directed towards the middle region of Human SLC25A10. Synthetic peptide located within the following region: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: solute carrier family 25 member 10
• Database Link:
  NP_036272
  Q9UBX3
• Background: The dicarboxylate carrier catalyzes the transport of dicarboxylates such as malate and succinate across the mitochondrial membrane in exchange for phosphate, sulfate, and thiosulfate, thus supplying substrates for the Krebs cycle, gluconeogenesis, urea synthesis, and sulfur metabolism.
• Synonyms: DIC
• Note: Human: 100%; Sheep: 86%; Bovine: 86%; Zebrafish: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data