Dermokine (DMKN) Rabbit Polyclonal Antibody

SKU TA331201

Rabbit Polyclonal Anti-DMKN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DMKN antibody is: synthetic peptide directed towards the C-terminal region of Human DMKN. Synthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: dermokine
• Database Link:
  NP_001177276
  Q6E0U4
• Background: This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain components. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Synonyms: UNQ729; ZD52F10
• Note: Human: 100%; Dog: 86%; Bovine: 86%; Rabbit: 86%

Reference Data