CA150 (TCERG1) Rabbit Polyclonal Antibody

SKU TA331184

Rabbit Polyclonal Anti-TCERG1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCERG1 antibody: synthetic peptide directed towards the middle region of human TCERG1. Synthetic peptide located within the following region: LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 124 kDa
• Gene Name: transcription elongation regulator 1
• Database Link:
  NP_001035095
  O14776
• Background: TCERG1 is a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. TCERG1 interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
• Synonyms: CA150; TAF2S; Urn1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Yeast: 83%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Spliceosome