MYT1 Rabbit Polyclonal Antibody

SKU TA331118

Rabbit Polyclonal Anti-MYT1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYT1 antibody: synthetic peptide directed towards the N terminal of human MYT1. Synthetic peptide located within the following region: CTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 122 kDa
• Gene Name: myelin transcription factor 1
• Database Link:
  NP_004526
  Q01538
• Background: The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq, Jul 2008]
• Synonyms: C20orf36; MTF1; MYTI; NZF2; PLPB1; ZC2H2C1; ZC2HC4A
• Note: Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Rabbit: 92%; Pig: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors