CITED1 Rabbit Polyclonal Antibody

SKU TA331117

Rabbit Polyclonal Anti-CITED1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CITED1 antibody: synthetic peptide directed towards the middle region of human CITED1. Synthetic peptide located within the following region: IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1
• Database Link:
  NP_004134
  Q99966
• Background: CBP/p300-interacting transactivator 1 (CITED1, melanocyte-specific protein 1 ) is a nuclear protein that shares two highly conserved domains, CR1 and CR2. The CR2 domain is significantly acidic and activates transcription in yeast cells.
• Synonyms: MSG1
• Note: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 83%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors