CITED1 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CITED1 antibody: synthetic peptide directed towards the middle region of human CITED1. Synthetic peptide located within the following region: IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 20 kDa |
Gene Name | Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1 |
Database Link | |
Background | CBP/p300-interacting transactivator 1 (CITED1, melanocyte-specific protein 1 ) is a nuclear protein that shares two highly conserved domains, CR1 and CR2. The CR2 domain is significantly acidic and activates transcription in yeast cells. |
Synonyms | MSG1 |
Note | Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 83%; Mouse: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review