SLC10A3 Rabbit Polyclonal Antibody

CAT#: TA331093

Rabbit polyclonal Anti-SLC10A3 Antibody

Product Images

WB Suggested Anti-SLC10A3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate; SLC10A3 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC10A3 antibody: synthetic peptide directed towards the middle region of human SLC10A3. Synthetic peptide located within the following region: MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 10 member 3
• Database Link:
  NP_062822
  Entrez Gene 8273 Human
  UniProt ID P09131
• Background: This gene maps to a GC-rich region of the X chromosome and was identified by its proximity to a CpG island. It is thought to be a housekeeping gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Synonyms: DXS253E; P3
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane