SMCR7L (MIEF1) Rabbit Polyclonal Antibody

SKU TA331075

Rabbit polyclonal Anti-SMCR7L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMCR7L antibody: synthetic peptide directed towards the N terminal of human SMCR7L. Synthetic peptide located within the following region: GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: mitochondrial elongation factor 1
• Database Link:
  NP_061881
  Q9NQG6
• Background: The specific function of this protein remains unknown.
• Synonyms: dJ1104E15.3; HSU79252; MID51; SMCR7L
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane