THSD1 Rabbit Polyclonal Antibody

CAT#: TA331050

Rabbit polyclonal Anti-THSD1 Antibody

Product Images

Host: Rabbit; Target Name: THSD1; Sample Tissue: A549 Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-THSD1 antibody is: synthetic peptide directed towards the middle region of Human THSD1. Synthetic peptide located within the following region: AQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: thrombospondin type 1 domain containing 1
• Database Link:
  NP_061146
  Entrez Gene 55901 Human
  UniProt ID Q9NS62
• Background: The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
• Synonyms: TMTSP; UNQ3010
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane