Tmem165 Rabbit Polyclonal Antibody

SKU TA331044

Rabbit polyclonal Anti-Tmem165 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tmem165 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tmem165. Synthetic peptide located within the following region: MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: transmembrane protein 165
• Database Link:
  NP_035756
  P52875
• Background: The function of this protein remains unknown.
• Synonyms: TMPT27; TPARL
• Note: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 85%; Guinea pig: 85%

Reference Data