MEKK2 (MAP3K2) Rabbit Polyclonal Antibody
USD 665.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 70 kDa |
Gene Name | mitogen-activated protein kinase kinase kinase 2 |
Database Link | |
Background | MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-18 AF111105.1 37-54 19-79 AI760702.1 474-534 80-371 AF111105.1 116-407 372-2650 AB208963.1 313-2591 2651-3557 AK075004.1 2050-2956 3558-3571 BQ423724.1 71-84 3572-3577 W07290.1 11-16 3578-4302 AK074577.1 1-725 4303-4421 BM470563.1 21-139 4422-4424 AK074577.1 845-847 4425-4941 BM470563.1 142-658 |
Synonyms | MEKK2; MEKK2B |
Note | Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Zebrafish: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 92%; Mouse: 86%; Horse: 80% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Gap junction, GnRH signaling pathway, MAPK signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review