B3GALTL (B3GLCT) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-B3GALTL antibody: synthetic peptide directed towards the middle region of human B3GALTL. Synthetic peptide located within the following region: DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 56 kDa |
| Gene Name | beta 3-glucosyltransferase |
| Database Link | |
| Background | B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1; MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2; MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008 PubMed 18199743). supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 DN999521.1 41-310 271-457 AB101481.1 161-347 458-467 DN999521.1 499-508 468-1217 AB101481.1 358-1107 1218-1279 DA290408.1 515-576 1280-1607 AB101481.1 1170-1497 1608-2495 AY190526.1 1498-2385 2496-3459 AY190526.1 2387-3350 3460-4071 AV728071.1 87-698 4072-4221 AA769548.1 1-150 c |
| Synonyms | B3GALTL; B3Glc-T; B3GTL; beta3Glc-T; Gal-T |
| Note | Human: 100%; Dog: 93%; Rat: 79%; Mouse: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Peters plus syndrome mutations affect the function and stability of human β1,3-glucosyltransferase
Zhang, Venkat, Taujale et al
J Biol Chem (2021) 297 (1), 100843 DOI: 10.1016/j.jbc.2021.100843
Zhang, Venkat, Taujale et al
J Biol Chem (2021) 297 (1), 100843 DOI: 10.1016/j.jbc.2021.100843
Cited by 13
AI Summary: In this study, OriGene's anti-B3GLCT antibody was used to detect B3GLCT protein expression in cell lysates, enabling the assessment of how Peters Plus Syndrome mutations affect the function and stability of human β1,3-glucosyltransferase.
Snippet: 66∗, and R412∗. In Figure 4A, we did not detect Y366∗ and R412∗ in B3GLCT−/− cell lysate as these two premature stop codon mutations eliminated the epitope for the anti-B3GLCT antibody (OriGene) that was used in these experiments. To overcome this issue, we inserted an N-terminal His6-tag immediately after the signal peptide of the human B3GLCT-FL plasmid construct and introduced Y36
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
