UGT3A2 Rabbit Polyclonal Antibody

CAT#: TA330999

Rabbit polyclonal Anti-UGT3A2 Antibody

Product Images

WB Suggested Anti-UGT3A2 Antibody Titration: 2.5ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UGT3A2 antibody: synthetic peptide directed towards the N terminal of human UGT3A2. Synthetic peptide located within the following region: HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: UDP glycosyltransferase family 3 member A2
• Database Link:
  NP_777574
  Entrez Gene 167127 Human
  UniProt ID Q3SY77
• Background: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
• Synonyms: MGC119426; MGC119429
• Note: Human: 100%

Reference Data

• Protein Families: Transmembrane