AER61 (EOGT) Rabbit Polyclonal Antibody

CAT#: TA330995

Reviews ()
Write a review

Rabbit polyclonal Anti-C3orf64 Antibody


 Product Datasheet for 'TA330995'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C3orf64 antibody: synthetic peptide directed towards the C terminal of human C3orf64. Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 52 kDa
Gene Name EGF domain specific O-linked N-acetylglucosamine transferase
Background The exact function of C3orf64 remains unknown.
Synonyms AER61; AOS4; C3orf64; EOGT1
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Other products for "EOGT"
Frequently bought together (2)
Transient overexpression lysate of chromosome 3 open reading frame 64 (C3orf64)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones