B4GALNT3 Rabbit Polyclonal Antibody

SKU TA330994

Rabbit polyclonal Anti-B4GALNT3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B4GALNT3 antibody: synthetic peptide directed towards the N terminal of human B4GALNT3. Synthetic peptide located within the following region: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 115 kDa
• Gene Name: beta-1,4-N-acetyl-galactosaminyltransferase 3
• Database Link:
  NP_775864
  Q6L9W6
• Background: B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.
• Synonyms: FLJ16224; FLJ40362
• Note: Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane