B4GALNT3 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of beta-1,4-N-acetyl-galactosaminyl transferase 3 (B4GALNT3)
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "B4GALNT3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-B4GALNT3 antibody: synthetic peptide directed towards the N terminal of human B4GALNT3. Synthetic peptide located within the following region: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 115 kDa |
Gene Name | beta-1,4-N-acetyl-galactosaminyltransferase 3 |
Database Link | |
Background | B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa. |
Synonyms | FLJ16224; FLJ40362 |
Note | Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.