B4GALNT3 Rabbit Polyclonal Antibody

CAT#: TA330994

Rabbit polyclonal Anti-B4GALNT3 Antibody

Product Images

WB Suggested Anti-B4GALNT3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B4GALNT3 antibody: synthetic peptide directed towards the N terminal of human B4GALNT3. Synthetic peptide located within the following region: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: beta-1,4-N-acetyl-galactosaminyltransferase 3
• Database Link:
  NP_775864
  Entrez Gene 283358 Human
  UniProt ID Q6L9W6
• Background: B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.
• Synonyms: FLJ16224; FLJ40362
• Note: Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane