B3GALNT2 Rabbit Polyclonal Antibody

SKU TA330976

Rabbit polyclonal Anti-B3GALNT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3GALNT2 antibody: synthetic peptide directed towards the middle region of human B3GALNT2. Synthetic peptide located within the following region: PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: beta-1,3-N-acetylgalactosaminyltransferase 2
• Database Link:
  NP_689703
  Q8NCR0
• Background: B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
• Synonyms: B3GalNAc-T2; MDDGA11
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data